PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g021070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CPP
Protein Properties Length: 972aa    MW: 104798 Da    PI: 6.7927
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g021070.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.51.7e-15551589341
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                       +k+CnCkk+kClk+YC+Cfaag++C ++C+C++C N+ e
  Sopen08g021070.1 551 CKRCNCKKTKCLKLYCDCFAAGVYCVDSCTCQGCLNRPE 589
                       79**********************************876 PP

2TCR50.54.2e-16638676139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++k+gCnCkks ClkkYCeC++a++ Cs+ C+Ce+CkN 
  Sopen08g021070.1 638 RHKRGCNCKKSMCLKKYCECYQANVGCSSGCRCEGCKNV 676
                       589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.5E-14549590IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.191550678IPR005172CRC domain
PfamPF036382.0E-11552587IPR005172CRC domain
SMARTSM011143.5E-17638679IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-11640675IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MDSPEPSSVI NATINTTLSS DPGPAQDSPV FNYISNLSPI QPVKGAPIVQ DFSGLNSPPL  60
LLTSPRINTH SRSSLLKRSQ FPKLSTEVFS GKNEDYNNAI TDSDGTGVFI YPLRSGLSPS  120
VQKVSDNNIS VHEQSGTPIS CVDEFLVDVS NSESGNPSNS NNTSPKVADS IPQPPNSAED  180
SKVPVVSIAS KDERKDEIPE DAAHVVVEQA EEDNKGKSPS NQKYTVVYST SNPDLPSLGL  240
CTKIVPGFDA HSSLHNHYGD RQMAQLSRAG HTMLDEASNI PIKSLETARD CRDDNNKIST  300
MSIVPDDDIL QHDSQTKASQ HQSGISRRCL QFEDAQQKMA PASSSSQNAS GIVSCSIQPV  360
SPAVIEVVEP VLSNRSSTTS NRRLTQLVSS SVNSESLNVK VSKPSGIGLH LNSIVNGMEA  420
GSGVTVSVKS TQRGNLSIRG KKLTSMMSCH PSKNLKNCLI SSNVVGSNLT SGDNDGIHES  480
YRSDAESAAA SLSHNNAKPL NDTVLLKPTE HTPSNKRKLN SEHIDSNMDY NQSSPQKKRK  540
KTSDGNDGDG CKRCNCKKTK CLKLYCDCFA AGVYCVDSCT CQGCLNRPEY EDTVLDVRQQ  600
IQSRNPLAFA PKIVQHSTSS PANILGEGVA SFTPSSARHK RGCNCKKSMC LKKYCECYQA  660
NVGCSSGCRC EGCKNVFGPK EDYGIDLVNK HCITERLERS VEEEVEMVTA TSGLLQSGPI  720
NECNSTPLTP SFRRSNNVDA SKSWFTSGRY LSSPESGQAN TAPYGLSPGS PRSSNNHDIH  780
QESTGDMLDL VTFDHELSYG NAKLANEISP GFNVTGNMDD ILALPKSQDW ACNSGGQLIP  840
QTVHFQSTDP LSWRNSPMTH MTQFDGSGMN ALELLDSDKK PYVLEDDTPE ILKDSSIPQI  900
GVKVNSPNKK RVSPPYRHLN EIGSSSPGGG LKSGRKFILR AVPSFPPLSP CIQSKNVAAH  960
STNNSEKDSS SK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1536540KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015085212.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
RefseqXP_015085213.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLK4CLU10.0K4CLU1_SOLLC; Uncharacterized protein
STRINGSolyc08g067150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69802128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-62TESMIN/TSO1-like CXC 2